PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17958A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MIKC_MADS
Protein Properties Length: 283aa    MW: 31862.3 Da    PI: 8.5827
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17958AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.45.8e-31108157150
                                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                     SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                                krien +nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  Oropetium_20150105_17958A 108 KRIENPTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 157
                                79***********************************************8 PP

2K-box71.33e-2415722433100
                      K-box  33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                                 ++R ++G+ ++ +sl++L+qLe +Lek+++kiR++Knell+++++++qk+e el+++n +Lr+k++e
  Oropetium_20150105_17958A 157 ANHRTIVGDAVHAMSLRDLKQLEGKLEKGITKIRARKNELLYAEVDYMQKREMELHSDNIYLRNKVAE 224
                                589**************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-41100159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.856100160IPR002100Transcription factor, MADS-box
CDDcd002658.80E-41101158No hitNo description
SuperFamilySSF554551.44E-29101160IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-33102122IPR002100Transcription factor, MADS-box
PROSITE patternPS003500102156IPR002100Transcription factor, MADS-box
PfamPF003199.1E-27109156IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-33122137IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.772136228IPR002487Transcription factor, K-box
PRINTSPR004049.3E-33137158IPR002100Transcription factor, MADS-box
PfamPF014861.7E-17157222IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MDWEGTARRA MGIVGHSLQL LLLTAPPLHA FPFPHHLSLI PLASFLSSCS FRLLSYYPLS  60
LSGSHSSPIW PDDLSCGLSK VTEQPTPANS GPSAGSDNKP GRGKIEIKRI ENPTNRQVTF  120
CKRRNGLLKK AYELSVLCDA EVALIVFSSR GRLYEYANHR TIVGDAVHAM SLRDLKQLEG  180
KLEKGITKIR ARKNELLYAE VDYMQKREME LHSDNIYLRN KVAENEREHE QQMSMQIAAA  240
STSEYDHVIP SYDSRNFLQV NVMQQQQQQY SHQPQPTTLQ LG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-19101158158Myocyte-specific enhancer factor 2A
3mu6_B1e-19101158158Myocyte-specific enhancer factor 2A
3mu6_C1e-19101158158Myocyte-specific enhancer factor 2A
3mu6_D1e-19101158158Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306379e-68AJ430637.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m23 gene).
GenBankEU9608109e-68EU960810.1 Zea mays clone 228787 MADS-box transcription factor 3 mRNA, complete cds.
GenBankKT1887749e-68KT188774.1 Triticum urartu WAG-2a MADS box transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968556.11e-100PREDICTED: MADS-box transcription factor 3 isoform X1
RefseqXP_004968558.11e-100PREDICTED: MADS-box transcription factor 3 isoform X2
SwissprotQ407046e-92MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0A8XZ731e-109A0A0A8XZ73_ARUDO; Uncharacterized protein
STRINGSb03g002525.11e-97(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.24e-63MIKC_MADS family protein